DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k01209 and DAS2

DIOPT Version :9

Sequence 1:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_010303.3 Gene:DAS2 / 851583 SGDID:S000002427 Length:232 Species:Saccharomyces cerevisiae


Alignment Length:217 Identity:50/217 - (23%)
Similarity:95/217 - (43%) Gaps:38/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 VIGICGGSASGKTTVA-------EKIIESLDVPWVTLLSM-DCFYKILNEKQHEQALINEYNFDH 244
            ||.|.||.|:|...:|       :.:..|:::..:.|.:| :...|..|.        |:|:|| 
Yeast    12 VISIGGGHATGVGAIALDLQNTFKSLYNSINIRVINLDNMIEGNIKSYNN--------NDYDFD- 67

  Fly   245 PDAFDIELLLDVLTKLKEGRKVEVPVYNFVTHGRESQTKTMYGANVIIFEGILTFHSPEVLKLLD 309
                      ::|..:.|...| ....:.:.|..|..      .::||..|....:...:.::..
Yeast    68 ----------NILNLVYEKHAV-TSQNDMIQHDYEDP------IDLIIVCGCYALYDKRINEISQ 115

  Fly   310 MKIFVDTDPDIRLARRLRRDISQRGRDLKGVLKQYLNMVKPSYCNYIAPTMAHADIIVPRGGDN- 373
            :|:|:|:|.|.||...:::........|..::.:|::.::|....||.||...||:|:|...:| 
Yeast   116 LKVFLDSDADKRLISLIKKKNVGSNEQLAQLITEYMDHLRPEMQQYIEPTRTFADLIIPSTNENL 180

  Fly   374 --KVAIHLIVQHVH-TQLQLRG 392
              .|.:..||:.:. |:.|:.|
Yeast   181 GRAVLVDGIVKAIEDTKSQIEG 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645 50/217 (23%)
UMPK 188..387 CDD:238981 47/210 (22%)
UPRTase 417..620 CDD:291353
DAS2NP_010303.3 Udk 8..209 CDD:223645 50/217 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.