DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k01209 and UCK1

DIOPT Version :9

Sequence 1:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_005272281.1 Gene:UCK1 / 83549 HGNCID:14859 Length:291 Species:Homo sapiens


Alignment Length:220 Identity:106/220 - (48%)
Similarity:148/220 - (67%) Gaps:22/220 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 PFVIGICGGSASGK--------------TTVAEKIIESL---DVPW----VTLLSMDCFYKILNE 229
            ||:||:.||:||||              :||.|||:|.|   :|..    |.:||.|.|||:|..
Human    23 PFLIGVSGGTASGKDERFQAGIPLLCLQSTVCEKIMELLGQNEVEQRQRKVVILSQDRFYKVLTA 87

  Fly   230 KQHEQALINEYNFDHPDAFDIELLLDVLTKLKEGRKVEVPVYNFVTHGRESQTKTMYGANVIIFE 294
            :|..:||..:||||||||||.:|:...|..:.||:.||||.|:||||.|..:|..:|.|:|::||
Human    88 EQKAKALKGQYNFDHPDAFDNDLMHRTLKNIVEGKTVEVPTYDFVTHSRLPETTVVYPADVVLFE 152

  Fly   295 GILTFHSPEVLKLLDMKIFVDTDPDIRLARRLRRDISQRGRDLKGVLKQYLNMVKPSYCNYIAPT 359
            |||.|:|.|:..:..:::|||||.|:||:||:.||: :|||||:.:|.||...|||::..:..||
Human   153 GILVFYSQEIRDMFHLRLFVDTDSDVRLSRRVLRDV-RRGRDLEQILTQYTTFVKPAFEEFCLPT 216

  Fly   360 MAHADIIVPRGGDNKVAIHLIVQHV 384
            ..:||:|:|||.||.|||:|||||:
Human   217 KKYADVIIPRGVDNMVAINLIVQHI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645 106/220 (48%)
UMPK 188..387 CDD:238981 104/218 (48%)
UPRTase 417..620 CDD:291353
UCK1XP_005272281.1 Udk 22..246 CDD:223645 106/220 (48%)
UMPK 25..244 CDD:238981 104/218 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D509086at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.