DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k01209 and UPP

DIOPT Version :9

Sequence 1:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_190958.1 Gene:UPP / 824557 AraportID:AT3G53900 Length:296 Species:Arabidopsis thaliana


Alignment Length:210 Identity:62/210 - (29%)
Similarity:98/210 - (46%) Gaps:8/210 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 PTPQIKGLHTFIRCRNTSRDEFIFYSKRLIRLVI-EYALSLFPFKKTTVETPQG---VLYEGKRM 477
            |.|.||...:.:|...|....|......|.||:: |.:....|.....:.:|.|   |.:...| 
plant    85 PHPLIKHWISVLRNEQTPCPVFRNAIAELGRLLMYEASREWLPTVVGEIMSPMGPASVEFIDPR- 148

  Fly   478 ESRKICGVSILRAGETMEQAVCDVCKDIRIGKILIQTNLKTGEPELYYLRLPKDI-KDYKVILMD 541
              ..|..|.|||||..:.:....|....:|..:.:..:.||..|.:|..:||.:. |:.:|.|:|
plant   149 --EPIAVVPILRAGLALAEHASSVLPANKIYHLGVSRDEKTLLPSVYLNKLPDEFPKNSRVFLVD 211

  Fly   542 ATVATGAAAMMAIRVLLDHDVPEDNIILASLLMAEIGVHSIAYAFPKVKIVTSALDPEINSKFYV 606
            ..:|||...|.|:.:|.:..:....|.:...:.|...:..:...||.:.:....:|||:|.|.|:
plant   212 PVLATGGTIMAAMDLLKERGLSVQQIKVICAIAAPPALSKLNEKFPGLHVYAGIIDPEVNEKGYI 276

  Fly   607 IPGIGNFGDRYFGTE 621
            |||:|:.|||.||||
plant   277 IPGLGDAGDRSFGTE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645
UMPK 188..387 CDD:238981
UPRTase 417..620 CDD:291353 59/207 (29%)
UPPNP_190958.1 PLN02541 48..291 CDD:215297 60/208 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.