DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k01209 and PECT1

DIOPT Version :9

Sequence 1:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_181401.1 Gene:PECT1 / 818449 AraportID:AT2G38670 Length:421 Species:Arabidopsis thaliana


Alignment Length:281 Identity:57/281 - (20%)
Similarity:97/281 - (34%) Gaps:86/281 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 TTVAEKIIESLDVPWVTLLSMDCFYKILNEKQHEQALINEYNFDH----------PDAFDIELLL 254
            |.:.|::.....|.||..:..|..|.|..:  ..:.|.:||..|:          ||..|...|.
plant   103 TPLHERMTMVKAVKWVDEVISDAPYAITED--FMKKLFDEYQIDYIIHGDDPCVLPDGTDAYALA 165

  Fly   255 DVLTKLKEGRKVE-VPVYNFV--------------THGRES-QTKTMYGANVIIFE------GIL 297
            ....:.|:.::.| |...:.|              ||.|.| |.:..:|.:...||      |..
plant   166 KKAGRYKQIKRTEGVSSTDIVGRMLLCVRERSISDTHSRSSLQRQFSHGHSSPKFEDGASSAGTR 230

  Fly   298 TFH----SPEVLKLLDMK--------IFVDTDPDIRLARRLRRDISQRGRDL------------- 337
            ..|    |..:::..:.|        |::|...|:..|..:  :|.:|.|:|             
plant   231 VSHFLPTSRRIVQFSNGKGPGPDARIIYIDGAFDLFHAGHV--EILRRARELGDFLLVGIHNDQT 293

  Fly   338 ----KGVLKQYLNMVKPSY----CNYIAPTMAHADIIVPRGGDNKVAIHLIVQHVHTQLQLRGFK 394
                :|..:..:|:.:.|.    |.|:...:..|...|.|.......|.|:|             
plant   294 VSAKRGAHRPIMNLHERSLSVLACRYVDEVIIGAPWEVSRDTITTFDISLVV------------- 345

  Fly   395 LRETLANS---YKDQPMPHSL 412
             ..|:|.|   .|::..|:|:
plant   346 -HGTVAESDDFRKEEDNPYSV 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645 51/261 (20%)
UMPK 188..387 CDD:238981 51/251 (20%)
UPRTase 417..620 CDD:291353
PECT1NP_181401.1 PLN02406 1..421 CDD:215227 57/281 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.