DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k01209 and Uck2

DIOPT Version :9

Sequence 1:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_030099584.1 Gene:Uck2 / 80914 MGIID:1931744 Length:265 Species:Mus musculus


Alignment Length:214 Identity:104/214 - (48%)
Similarity:149/214 - (69%) Gaps:10/214 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 SGKTTVAEKIIESL---DVPW----VTLLSMDCFYKILNEKQHEQALINEYNFDHPDAFDIELLL 254
            :|.::|..||::.|   :|.:    |.:||.|.||::|..:|..:||..::|||||||||.||:.
Mouse    35 AGSSSVCAKIVQLLGQNEVDYHQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELIF 99

  Fly   255 DVLTKLKEGRKVEVPVYNFVTHGRESQTKTMYGANVIIFEGILTFHSPEVLKLLDMKIFVDTDPD 319
            ..|.::.||:.|::|||:||:|.|:.:|.|:|.|:|::|||||.|:|.||..|..||:|||||.|
Mouse   100 KTLKEITEGKTVQIPVYDFVSHSRKEETVTIYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDAD 164

  Fly   320 IRLARRLRRDISQRGRDLKGVLKQYLNMVKPSYCNYIAPTMAHADIIVPRGGDNKVAIHLIVQHV 384
            .||:||:.||||:|||||:.:|.||:..|||::..:..||..:||:|:|||.||.|||:|||||:
Mouse   165 TRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHI 229

  Fly   385 HTQLQLRGFKLRETLANSY 403
            ...|. .|...|:|  |.|
Mouse   230 QDILN-GGLSKRQT--NGY 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645 100/206 (49%)
UMPK 188..387 CDD:238981 98/196 (50%)
UPRTase 417..620 CDD:291353
Uck2XP_030099584.1 UMPK 35..232 CDD:238981 98/196 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.