DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k01209 and UCK2

DIOPT Version :9

Sequence 1:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_036606.2 Gene:UCK2 / 7371 HGNCID:12562 Length:261 Species:Homo sapiens


Alignment Length:228 Identity:115/228 - (50%)
Similarity:162/228 - (71%) Gaps:10/228 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 EPFVIGICGGSASGKTTVAEKIIESL---DVPW----VTLLSMDCFYKILNEKQHEQALINEYNF 242
            |||:||:.||:||||::|..||::.|   :|.:    |.:||.|.||::|..:|..:||..::||
Human    19 EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNF 83

  Fly   243 DHPDAFDIELLLDVLTKLKEGRKVEVPVYNFVTHGRESQTKTMYGANVIIFEGILTFHSPEVLKL 307
            |||||||.||:|..|.::.||:.|::|||:||:|.|:.:|.|:|.|:|::|||||.|:|.||..|
Human    84 DHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDL 148

  Fly   308 LDMKIFVDTDPDIRLARRLRRDISQRGRDLKGVLKQYLNMVKPSYCNYIAPTMAHADIIVPRGGD 372
            ..||:|||||.|.||:||:.||||:|||||:.:|.||:..|||::..:..||..:||:|:|||.|
Human   149 FQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGAD 213

  Fly   373 NKVAIHLIVQHVHTQLQLRGFKLRET--LANSY 403
            |.|||:|||||:...|. .|...|:|  ..|.|
Human   214 NLVAINLIVQHIQDILN-GGPSKRQTNGCLNGY 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645 110/217 (51%)
UMPK 188..387 CDD:238981 106/205 (52%)
UPRTase 417..620 CDD:291353
UCK2NP_036606.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 3/4 (75%)
UMPK 22..228 CDD:238981 106/205 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..261 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D509086at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.