DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k01209 and mibp

DIOPT Version :9

Sequence 1:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_571768.2 Gene:mibp / 64674 ZFINID:ZDB-GENE-030404-1 Length:201 Species:Danio rerio


Alignment Length:142 Identity:36/142 - (25%)
Similarity:64/142 - (45%) Gaps:32/142 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 FVIGICGGSASGKTTVAEKIIESLDVPWVTLLSMDCFYKILNEKQHEQALINEYNF---DHPDAF 248
            |:|||.|.:..||||:..::|::|  |...::..|.|:     |..:|..:....|   |..||.
Zfish     3 FIIGIGGVTNGGKTTLTNRLIKAL--PNCCVVHQDDFF-----KPPDQIAVGMDGFKQWDVIDAL 60

  Fly   249 DIELLLDVLTKLKEGRKVEVPVYNFVTHG-----------RESQTKTMYGANVIIFEGILTFHSP 302
            |:|.:::.:...     :|.||....:||           .|||      .:::|.||.|.::..
Zfish    61 DMEAMVNTIKGW-----LENPVKFARSHGIQVTPATEMEDPESQ------VHILIVEGFLLYNYK 114

  Fly   303 EVLKLLDMKIFV 314
            .:|.:.|...::
Zfish   115 PLLDVFDKSYYI 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645 36/142 (25%)
UMPK 188..387 CDD:238981 35/141 (25%)
UPRTase 417..620 CDD:291353
mibpNP_571768.2 NRK1 4..170 CDD:238982 35/141 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.