DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k01209 and NMRK1

DIOPT Version :9

Sequence 1:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001317607.1 Gene:NMRK1 / 54981 HGNCID:26057 Length:203 Species:Homo sapiens


Alignment Length:159 Identity:38/159 - (23%)
Similarity:73/159 - (45%) Gaps:18/159 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 SGKTTVAEKIIESLDVPWVTLLSMDCFYKILNEKQHEQALINEYNFDHPDAFDIELLLDVLTKLK 261
            |||||:|:.:.:.|  |..:::|.|.|:|..:|.:.::....:|  |..:|.::|.::..::...
Human    18 SGKTTLAKNLQKHL--PNCSVISQDDFFKPESEIETDKNGFLQY--DVLEALNMEKMMSAISCWM 78

  Fly   262 EGRKVEVPVYNFVTHGRESQTKTMYGANVIIFEGILTFHSPEVLKLLDMKIFVDTDPDIRLARRL 326
            |..:     ::.|:..:||..:    ..::|.||.|.|:...:..:.:...|: |.|.....||.
Human    79 ESAR-----HSVVSTDQESAEE----IPILIIEGFLLFNYKPLDTIWNRSYFL-TIPYEECKRRR 133

  Fly   327 RRDISQRGRDLKGVLKQYLNMVKPSYCNY 355
            ...:.| ..|..|....:   |.|.|..|
Human   134 STRVYQ-PPDSPGYFDGH---VWPMYLKY 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645 38/159 (24%)
UMPK 188..387 CDD:238981 38/159 (24%)
UPRTase 417..620 CDD:291353
NMRK1NP_001317607.1 NRK1 12..164 CDD:238982 38/159 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.