DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k01209 and nmrk1

DIOPT Version :9

Sequence 1:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_017209594.1 Gene:nmrk1 / 541321 ZFINID:ZDB-GENE-050320-8 Length:213 Species:Danio rerio


Alignment Length:174 Identity:39/174 - (22%)
Similarity:61/174 - (35%) Gaps:48/174 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 VIGICGGSASGKTTVAEKIIESLDVPWVTLLSMD------CFYKILNEK-----QHEQALINEYN 241
            ||...|.||:.|..:::|     |...|:|.:..      .:|.|.:.|     .||..:  |..
Zfish    29 VIKFKGESATMKCHISDK-----DAMGVSLFTRHKDKQEVLYYFIQSNKLTIKPTHEGRV--EAK 86

  Fly   242 FDHPDAFDIELLLDVLTKLKEGR---------------KVEVPVYNFVTHGRESQTKT------- 284
            ||..     .|.:|:|...||..               |::......|.|.||.|..|       
Zfish    87 FDGK-----TLTVDILNLQKEDTGAYWCECNHIVTRECKMDQSGVVLVVHDRERQQNTGQVSAST 146

  Fly   285 ---MYGANVIIFEGILTFHSPEVLKLLDMKIFVDTDPDIRLARR 325
               .:|....:...::...:..||.||.:.:.|...|.|:..|:
Zfish   147 APSKFGGMNGLLVPVVALTASSVLLLLLLVLGVWVVPKIKKMRQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645 39/174 (22%)
UMPK 188..387 CDD:238981 39/174 (22%)
UPRTase 417..620 CDD:291353
nmrk1XP_017209594.1 V-set 34..131 CDD:311561 23/108 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.