DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k01209 and Nmrk1

DIOPT Version :9

Sequence 1:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_008758512.1 Gene:Nmrk1 / 499330 RGDID:1564687 Length:213 Species:Rattus norvegicus


Alignment Length:227 Identity:53/227 - (23%)
Similarity:95/227 - (41%) Gaps:44/227 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 VEPFVIGICGGSASGKTTVAEKIIESLDVPWVTLLSMDCFYKILNEKQHEQALINEYNF---DHP 245
            ::.|||||.|.:..||||:|:.:.:.|  |..:::|.|.|:|..:|..     |:|..|   |..
  Rat     1 MKTFVIGIGGVTNGGKTTLAKNLQKRL--PNCSVISQDDFFKPESEID-----IDENGFLQYDVL 58

  Fly   246 DAFDIELLLDVLTKLKEGRKVEVPVYNFVTHGRESQTKTMYGANVIIFEGILTFHSPEVLKLLDM 310
            :|.::|.::..::...|         |..:....:..::..|..::|.||.|.|:...:..:.:.
  Rat    59 EALNMEKMMSAVSCWME---------NPGSSAGPAALESAQGVPILIIEGFLLFNYKPLDTIWNR 114

  Fly   311 KIFVDTDPDIRLARRLRRDISQRGRDLKGVLKQYLNMVKPSYCN-------------YIAPTMAH 362
            ..|: |.|.....|| |........|..|....:   |.|.|..             |:..|.:.
  Rat   115 SYFL-TVPYEECKRR-RSTRVYEPPDPPGYFDGH---VWPMYLKHRQEMNSITWDIVYLDGTRSE 174

  Fly   363 ADII------VPRGGDNKVAIHLI-VQHVHTQ 387
            .|:.      |.:..:.:.|:.|: |.||::|
  Rat   175 EDLFSQVYEDVKQELEKQNAVRLLEVHHVYSQ 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645 53/225 (24%)
UMPK 188..387 CDD:238981 51/221 (23%)
UPRTase 417..620 CDD:291353
Nmrk1XP_008758512.1 NRK1 5..158 CDD:238982 42/173 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.