DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k01209 and mibp2

DIOPT Version :9

Sequence 1:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_942578.1 Gene:mibp2 / 386710 ZFINID:ZDB-GENE-031113-14 Length:203 Species:Danio rerio


Alignment Length:226 Identity:53/226 - (23%)
Similarity:93/226 - (41%) Gaps:51/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 FVIGICGGSASGKTTVAEKIIESLDVPWVTLLSMDCFYKILNEKQHEQALINEYNFDHPDAFDIE 251
            |:|||.|.:..||||:.:::|:||  |...::..|.|:|..:|.:.::....:|  |...|.|::
Zfish     3 FIIGIGGVTNGGKTTLTDRLIKSL--PNCCVVHQDDFFKPQDEIEVDEDGFKQY--DVISALDMD 63

  Fly   252 LLLDVLTKLKEGRKVEVPVYNFVTHG-----------RESQTKTMYGANVIIFEGILTFHSPEVL 305
            .::..:...:..     ||....:||           ||..     |.:::|.||.|.:....::
Zfish    64 AMMSTIHAWQHD-----PVKFERSHGVNNSLEIRPRAREDD-----GVHILIVEGFLLYTYGPLI 118

  Fly   306 KLLDMKIFVDTDPDIRLARRLRRDISQRGRDLKGVLKQYLNMVKPSYCNYIAPTMAHADIIVPRG 370
            .:.:.:.|:....:....||..|:.:.  .|..|:...:   |.|.|       :.|..|:...|
Zfish   119 DVFNQRYFISIPYEECKKRRSSRNYAV--PDPPGLFDGH---VWPMY-------VKHTKIMEDSG 171

  Fly   371 GDNKVAIHLIVQHVHTQLQLRGFKLRETLAN 401
            .|  ||            ||.|...:|.|.|
Zfish   172 VD--VA------------QLDGTMSKEQLYN 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645 50/220 (23%)
UMPK 188..387 CDD:238981 46/209 (22%)
UPRTase 417..620 CDD:291353
mibp2NP_942578.1 NRK1 4..171 CDD:238982 42/192 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.