DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k01209 and C47B2.2

DIOPT Version :9

Sequence 1:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001252032.1 Gene:C47B2.2 / 3565732 WormBaseID:WBGene00008131 Length:231 Species:Caenorhabditis elegans


Alignment Length:254 Identity:89/254 - (35%)
Similarity:134/254 - (52%) Gaps:36/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 IVPRGGDNKVAIHLIVQHVHTQLQLRGFKLRETLANSYKDQPMPHSLHLLHPTPQIKGLHTFIRC 430
            ::|:.||.:..:..:|.:           |:|...|          ..||..||||..|.|.::.
 Worm    12 VIPKVGDEEDGVGQLVAN-----------LKEKGTN----------FVLLKKTPQILELQTILKD 55

  Fly   431 RNTSRDEFIFYSKRLIRLVIEYALSLFPFKKTTVETPQGVLYEGKRMESRKICGVSILRAGETME 495
            |:|:..:|:|.:.||:|||||..|:..||.:.||.||.|..|||.:. :|..||||:.|:||.||
 Worm    56 RSTNHSDFVFNADRLMRLVIEECLNHLPFTEHTVTTPTGFKYEGIQF-NRGNCGVSLCRSGEAME 119

  Fly   496 QAVCDVCKDIRIGKILIQTNLKTGEPELYYLRLPKDIKDYKVILMDATVATGAAAMMAIRVLLDH 560
            .::...|:.||||||||     ..|.::.|.||..||...:|:|:..|:.:|.....||.||.:.
 Worm   120 VSLRQCCRCIRIGKILI-----GDEQKVLYARLLPDITSRRVLLLYPTIGSGTTVCKAIEVLKEA 179

  Fly   561 DVPEDNIILASLLMAEIGVHSIAYAFPKVKIVTSALDPEINSKFYVIPGIGNFGDRYFG 619
            .||::||.|.||.::..|:.:|...:|.:.:|.|    :|.|.:   |  .:|...|||
 Worm   180 RVPDENIYLVSLFISPTGLKNITRKYPYITVVAS----DITSLY---P--NHFSTSYFG 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645 5/30 (17%)
UMPK 188..387 CDD:238981 4/20 (20%)
UPRTase 417..620 CDD:291353 80/203 (39%)
C47B2.2NP_001252032.1 UPRTase 43..215 CDD:291353 73/181 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.