DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k01209 and Uprt

DIOPT Version :9

Sequence 1:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_228538.3 Gene:Uprt / 317237 RGDID:1564806 Length:309 Species:Rattus norvegicus


Alignment Length:210 Identity:91/210 - (43%)
Similarity:127/210 - (60%) Gaps:10/210 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 LHLLHPTPQIKGLHTFIRCRNTSRDEFIFYSKRLIRLVIEYALSLFPFKKTTVETPQGVLYEGKR 476
            |.||....||:.|.|.||.:..||.:|:|.:.||||||:|..|:..|:|:..|.||.|..|||.:
  Rat   110 LKLLPMNDQIRELQTIIRDKTASRGDFMFSADRLIRLVVEEGLNQLPYKECMVTTPTGHKYEGVK 174

  Fly   477 MESRKICGVSILRAGETMEQAVCDVCKDIRIGKILIQTNLKTGEPELYYLRLPKDIKDYKVILMD 541
            .|... |||||:|:||.|||.:.|.|:.|||||||||::.:|...::||.:.|.||...||:||.
  Rat   175 FEKGN-CGVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQRAKVYYAKFPPDIHRRKVLLMY 238

  Fly   542 ATVATGAAAMMAIRVLLDHDVPEDNIILASLLMAEIGVHSIAYAFPKVKIVTSALDPEINSKFYV 606
            ..::||...:.|::||::|.|....|||.||.....|..||...||::.|:|:.:.|       |
  Rat   239 PILSTGNTVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSIIQEFPEITILTTEVHP-------V 296

  Fly   607 IPGIGNFGDRYFGTE 621
            .|  .:||.:||||:
  Rat   297 AP--THFGQKYFGTD 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645
UMPK 188..387 CDD:238981
UPRTase 417..620 CDD:291353 86/202 (43%)
UprtXP_228538.3 UPRTase 118..308 CDD:291353 86/199 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.