DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k01209 and urg2

DIOPT Version :9

Sequence 1:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_593505.2 Gene:urg2 / 2543260 PomBaseID:SPAC1002.17c Length:204 Species:Schizosaccharomyces pombe


Alignment Length:168 Identity:58/168 - (34%)
Similarity:87/168 - (51%) Gaps:7/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   455 SLFPFKKTTV--ETPQGVLYEG-KRMESRKICGVSILRAGETMEQAVCDVCKDIRIGKILIQTNL 516
            ||.|.:..:|  |..:.:.||. |.::|..:..|.:||:|.:|..|...|..|:.|..|.|....
pombe    38 SLKPSQVRSVVDEISRFLAYESTKTLKSPSVSIVPVLRSGMSMMSAFSKVLPDVPIYHIGIFREK 102

  Fly   517 KTGEPELYYLRLPKDIKDYKVILMDATVATGAAAMMAIRVLLDHDVPEDNIILASLLMAEIGVHS 581
            .|.:|..||.:|||...|..||| |..:|||..|...|..|.:...  .|||..|:|.:|..:..
pombe   103 STLQPIEYYNKLPKKSTDTAVIL-DPVMATGGTANAVITTLQEWGC--KNIIFVSVLASEQALTR 164

  Fly   582 IAYAFPKVKIVTSALDPEINSKFYVIPGIGNFGDRYFG 619
            .: ..|.|:.|..|:|..:::|.|::||:|:.|||.:|
pombe   165 FS-NIPGVEFVIGAVDKSLDAKGYLVPGVGDIGDRLYG 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645
UMPK 188..387 CDD:238981
UPRTase 417..620 CDD:291353 58/168 (35%)
urg2NP_593505.2 Upp 16..203 CDD:223113 58/168 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.