DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k01209 and SPAC227.14

DIOPT Version :9

Sequence 1:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001342927.1 Gene:SPAC227.14 / 2541483 PomBaseID:SPAC227.14 Length:235 Species:Schizosaccharomyces pombe


Alignment Length:168 Identity:38/168 - (22%)
Similarity:70/168 - (41%) Gaps:38/168 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 VIGICGGSASGKTTVAEKIIESLDVPW--------VTLLSMDCFYKILNEKQHEQALINEYNFDH 244
            :||:.||..|||:|:...:.::    |        |.::.||.|:..|.|..         .||:
pombe    31 LIGLAGGPGSGKSTLCAILAKA----WNERFGSEIVKIIPMDGFHYSLEELD---------RFDN 82

  Fly   245 PD----------AFDIELLLDVLTKLKE--GRKVEVPVYNFVTHGRESQTKTMYGAN-VIIFEG- 295
            |:          .||.:|...::..:|:  .|::..|.::............:...| ::|||| 
pombe    83 PEKARALRGAEWTFDADLFYSLVRLMKKITDRELYAPSFDHAIGDPVVDDICVEPKNRILIFEGN 147

  Fly   296 ILTFHSP---EVLKLLDMKIFVDTDPDIRLARRLRRDI 330
            .|..:.|   :..||.|:|.::..:..:..||...|.:
pombe   148 YLLLNKPPWSDACKLYDIKAYLPVEHSVARARVAHRHL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645 38/168 (23%)
UMPK 188..387 CDD:238981 38/168 (23%)
UPRTase 417..620 CDD:291353
SPAC227.14NP_001342927.1 CoaA 1..235 CDD:223998 38/168 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.