DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k01209 and Nmrk1

DIOPT Version :9

Sequence 1:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_663472.1 Gene:Nmrk1 / 225994 MGIID:2147434 Length:195 Species:Mus musculus


Alignment Length:117 Identity:32/117 - (27%)
Similarity:57/117 - (48%) Gaps:19/117 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 FVIGICGGSASGKTTVAEKIIESLDVPWVTLLSMDCFYKILNEKQHEQALINEYNF---DHPDAF 248
            |||||.|.:..||||:|:.:.:.|  |..:::|.|.|:|..:|..     |:|..|   |..:|.
Mouse     4 FVIGIGGVTNGGKTTLAKSLQKHL--PNCSVISQDDFFKPESEID-----IDENGFLQYDVLEAL 61

  Fly   249 DIELLLDVLTKLKEGRKVEVPVYNFVTHGRESQTKTMYGANVIIFEGILTFH 300
            ::|.::..::...|         |..:....:..::..|..::|.||.|.|:
Mouse    62 NMEKMMSAVSCWME---------NPGSSAGPAALESAQGVPILIIEGFLLFN 104

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645 32/117 (27%)
UMPK 188..387 CDD:238981 31/116 (27%)
UPRTase 417..620 CDD:291353
Nmrk1NP_663472.1 NRK1 5..158 CDD:238982 31/116 (27%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q9NWW6 36..39 1/2 (50%)