DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k01209 and B0001.4

DIOPT Version :9

Sequence 1:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_502304.2 Gene:B0001.4 / 178160 WormBaseID:WBGene00007089 Length:248 Species:Caenorhabditis elegans


Alignment Length:207 Identity:76/207 - (36%)
Similarity:120/207 - (57%) Gaps:9/207 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 PFVIGICGGSASGKTTVAEKIIESLDVPW--------VTLLSMDCFYKILNEKQHEQALINEYNF 242
            |.:||:.||::.||:|:.|:|||:|:...        :..||:..||:.|:.::...|...::||
 Worm     8 PLLIGVAGGTSCGKSTIVERIIENLNANAKQSGRQIDIVHLSLHSFYRELSAEEKILAREGKFNF 72

  Fly   243 DHPDAFDIELLLDVLTKLKEGRKVEVPVYNFVTHGRESQTKTMYGANVIIFEGILTFHSPEVLKL 307
            ||||..:.:||.:.|..:.:|:.||:|.|:.:|..... |.|:..|.|||.||||..:...|.||
 Worm    73 DHPDQINFDLLAETLQNMIDGKTVEIPKYDMITSSMNG-TVTVEPAKVIIIEGILLLYDERVRKL 136

  Fly   308 LDMKIFVDTDPDIRLARRLRRDISQRGRDLKGVLKQYLNMVKPSYCNYIAPTMAHADIIVPRGGD 372
            |..|:||:.:.:.||..||...|....|....:::||...|||::..:..||..:||:|:|||.|
 Worm   137 LSTKLFVEKNAESRLRNRLATYIRDYHRAPLSIIRQYTEFVKPAFEEFCRPTKKYADVIIPRGAD 201

  Fly   373 NKVAIHLIVQHV 384
            |.||..||.:::
 Worm   202 NHVATDLIAKNL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645 76/207 (37%)
UMPK 188..387 CDD:238981 75/205 (37%)
UPRTase 417..620 CDD:291353
B0001.4NP_502304.2 Udk 1..223 CDD:223645 76/207 (37%)
UMPK 10..216 CDD:238981 75/205 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D509086at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.