DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k01209 and uck1

DIOPT Version :9

Sequence 1:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_002936235.5 Gene:uck1 / 100491950 XenbaseID:XB-GENE-961187 Length:271 Species:Xenopus tropicalis


Alignment Length:211 Identity:109/211 - (51%)
Similarity:154/211 - (72%) Gaps:9/211 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 GQQVEPFVIGICGGSASGKTTVAEKIIESL---DVPW----VTLLSMDCFYKILNEKQHEQALIN 238
            |.| .||:||:.||:||||:||.|||:|.|   :|..    |.:||.|.|||:|..:|..:||..
 Frog    13 GHQ-RPFLIGVSGGTASGKSTVCEKIMELLGQNEVDHRQRKVVILSQDRFYKVLTPEQKARALKG 76

  Fly   239 EYNFDHPDAFDIELLLDVLTKLKEGRKVEVPVYNFVTHGRESQTKTMYGANVIIFEGILTFHSPE 303
            :||||||||||.||:...||::.||:.|:||:|:|:||.|..:|.|:|.|:|::|||||.|::.|
 Frog    77 QYNFDHPDAFDNELMHRTLTRIMEGQIVDVPMYDFITHSRLPETTTVYPADVVLFEGILAFYNQE 141

  Fly   304 VLKLLDMKIFVDTDPDIRLARRLRRDISQRGRDLKGVLKQYLNMVKPSYCNYIAPTMAHADIIVP 368
            :..:..:|:|||||.|:||:||:.||: :|||||:.:|.||...|||::..:..||..:||:|:|
 Frog   142 IRDMFQLKLFVDTDSDVRLSRRVLRDM-KRGRDLEQILSQYTTFVKPAFEEFSLPTKKYADVIIP 205

  Fly   369 RGGDNKVAIHLIVQHV 384
            ||.||.|||:|||||:
 Frog   206 RGVDNMVAINLIVQHI 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645 107/206 (52%)
UMPK 188..387 CDD:238981 105/204 (51%)
UPRTase 417..620 CDD:291353
uck1XP_002936235.5 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D509086at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.