DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k01209 and uprt

DIOPT Version :9

Sequence 1:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_002931835.1 Gene:uprt / 100487820 XenbaseID:XB-GENE-998574 Length:257 Species:Xenopus tropicalis


Alignment Length:232 Identity:97/232 - (41%)
Similarity:137/232 - (59%) Gaps:13/232 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 LRGFKLRETLANSYKDQPMPHSLHLLHPTPQIKGLHTFIRCRNTSRDEFIFYSKRLIRLVIEYAL 454
            |.|..|:|...:..:..|   .|.||....||:.|.|.||.|:|||.:|:|.:.||||||:|..|
 Frog    39 LDGLPLQELPKDQQQVGP---QLKLLPMNDQIRELQTIIRDRSTSRGDFVFSADRLIRLVVEEGL 100

  Fly   455 SLFPFKKTTVETPQGVLYEGKRMESRKICGVSILRAGETMEQAVCDVCKDIRIGKILIQTNLKTG 519
            :..|:.:.||.||.|..|:|.:.|... |||||:|:||.|||.:.|.|:.|||||||||::.:|.
 Frog   101 NQLPYTECTVTTPTGYKYDGVKFEKGN-CGVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQ 164

  Fly   520 EPELYYLRLPKDIKDYKVILMDATVATGAAAMMAIRVLLDHDVPEDNIILASLLMAEIGVHSIAY 584
            :.::||.:.|.||...||:||...::||...:.|::||::|.|....|||.||.....|..||..
 Frog   165 KAKVYYAKFPPDIYRRKVLLMYPILSTGNTVIEAVKVLIEHGVQPACIILLSLFSTPHGAISIIQ 229

  Fly   585 AFPKVKIVTSALDPEINSKFYVIPGIGNFGDRYFGTE 621
            .||.:.|:|:.:.|       |.|  .:||.:||||:
 Frog   230 EFPDITILTTEVHP-------VAP--THFGQKYFGTD 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645 3/6 (50%)
UMPK 188..387 CDD:238981
UPRTase 417..620 CDD:291353 87/202 (43%)
uprtXP_002931835.1 UPRTase 66..256 CDD:373220 87/199 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10285
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.140

Return to query results.
Submit another query.