Sequence 1: | NP_725672.2 | Gene: | l(2)k01209 / 36953 | FlyBaseID: | FBgn0022029 | Length: | 626 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001164538.1 | Gene: | uck2a / 100005763 | ZFINID: | ZDB-GENE-030131-7158 | Length: | 261 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 109/207 - (52%) |
---|---|---|---|
Similarity: | 152/207 - (73%) | Gaps: | 7/207 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 185 EPFVIGICGGSASGKTTVAEKIIESL-------DVPWVTLLSMDCFYKILNEKQHEQALINEYNF 242
Fly 243 DHPDAFDIELLLDVLTKLKEGRKVEVPVYNFVTHGRESQTKTMYGANVIIFEGILTFHSPEVLKL 307
Fly 308 LDMKIFVDTDPDIRLARRLRRDISQRGRDLKGVLKQYLNMVKPSYCNYIAPTMAHADIIVPRGGD 372
Fly 373 NKVAIHLIVQHV 384 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
l(2)k01209 | NP_725672.2 | Udk | 186..397 | CDD:223645 | 109/206 (53%) |
UMPK | 188..387 | CDD:238981 | 107/204 (52%) | ||
UPRTase | 417..620 | CDD:291353 | |||
uck2a | NP_001164538.1 | Udk | 21..232 | CDD:223645 | 109/207 (53%) |
UMPK | 24..229 | CDD:238981 | 107/204 (52%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0572 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D509086at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100147 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1606 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.750 |