Sequence 1: | NP_001286524.1 | Gene: | cnk / 36952 | FlyBaseID: | FBgn0286070 | Length: | 1557 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001165587.1 | Gene: | Samd3 / 685940 | RGDID: | 1587834 | Length: | 273 | Species: | Rattus norvegicus |
Alignment Length: | 246 | Identity: | 47/246 - (19%) |
---|---|---|---|
Similarity: | 91/246 - (36%) | Gaps: | 70/246 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 WTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVENLRN 73
Fly 74 FHYHLK--NDNLQFMALHVATAAKNLHRELA-RNHAESTK----------IDTRIL--------- 116
Fly 117 -------------------HDITRTIATLK----------------PLVGSLERTPFRKQEMYRE 146
Fly 147 YCGNVLK---------CGLELATIAHRDRFALQPVPAIRQSAERLENLANF 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cnk | NP_001286524.1 | SAM_CNK1,2,3-suppressor | 6..74 | CDD:188910 | 16/64 (25%) |
SAM | 7..74 | CDD:197735 | 16/64 (25%) | ||
CRIC_ras_sig | 82..165 | CDD:287501 | 22/146 (15%) | ||
PDZ_signaling | 206..283 | CDD:238492 | |||
PH | 720..814 | CDD:278594 | |||
PH_CNK_insect-like | 720..810 | CDD:270135 | |||
Samd3 | NP_001165587.1 | SAM | 1..66 | CDD:197735 | 16/64 (25%) |
SAM_superfamily | 1..65 | CDD:301707 | 16/63 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166352476 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |