DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnk and Samd3

DIOPT Version :9

Sequence 1:NP_001286524.1 Gene:cnk / 36952 FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_001165587.1 Gene:Samd3 / 685940 RGDID:1587834 Length:273 Species:Rattus norvegicus


Alignment Length:246 Identity:47/246 - (19%)
Similarity:91/246 - (36%) Gaps:70/246 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVENLRN 73
            |:.|||..|:  :::::...:..|.::|:.|.|||.:....::.| :.:||||.::::.::..:.
  Rat     4 WSVDQVCKWL--VEKNLGELVPRFQEEEVSGTALLALNDRMVQQL-VKKIGHQAVLMDFIKKYKQ 65

  Fly    74 FHYHLK--NDNLQFMALHVATAAKNLHRELA-RNHAESTK----------IDTRIL--------- 116
            .:..||  ..:.:...|.:..||....|.|: .:|.:.|.          ||.|:|         
  Rat    66 S
NQGLKPSGGSTETSLLTLVQAAPEHERNLSPTSHGDQTSLYPAVLDNRLIDQRVLKQRRNVKHV 130

  Fly   117 -------------------HDITRTIATLK----------------PLVGSLERTPFRKQEMYRE 146
                               :|:...:|..|                .:...||.:.:...:.|.:
  Rat   131 LARHKALHWTKSYVLPEFPYDVKCVLAEQKRPDHSMRIRIIEFLQADMTKYLEGSLYPTTQQYND 195

  Fly   147 YCGNVLK---------CGLELATIAHRDRFALQPVPAIRQSAERLENLANF 188
            ....:|:         ||..|...|.:|||.....| |....:.:.|...|
  Rat   196 VVNALLQAHPFLDEDGCGFFLWKRALKDRFKYVRRP-IEDDEQVMRNKCKF 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 16/64 (25%)
SAM 7..74 CDD:197735 16/64 (25%)
CRIC_ras_sig 82..165 CDD:287501 22/146 (15%)
PDZ_signaling 206..283 CDD:238492
PH 720..814 CDD:278594
PH_CNK_insect-like 720..810 CDD:270135
Samd3NP_001165587.1 SAM 1..66 CDD:197735 16/64 (25%)
SAM_superfamily 1..65 CDD:301707 16/63 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.