DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnk and IPCEF1

DIOPT Version :9

Sequence 1:NP_001286524.1 Gene:cnk / 36952 FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_001124171.1 Gene:IPCEF1 / 26034 HGNCID:21204 Length:438 Species:Homo sapiens


Alignment Length:473 Identity:116/473 - (24%)
Similarity:195/473 - (41%) Gaps:76/473 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   684 SELHTPSKSRTLTLKKKHSLMAKRRNTNLKLLGTGDIQGHLYRRKKNHRGVT-YWARIYFVMLDT 747
            |.|..|.:.:. ..|.:..|...||..:.|.||..|.||.||::|:....:: .|.:.:.::..:
Human    10 SALQVPLRQKP-RRKTQGFLTMSRRRISCKDLGHADCQGWLYKKKEKGSFLSNKWKKFWVILKGS 73

  Fly   748 ILYGFRSKQSTSASLVIFLPGFTVSLAKEVHSKPHAFKVYH-TAKSFYFAAESLDALNQWVDFLR 811
            .||.:.::.:..|...:.||.|||..|.|. .|.||||:.| ..|:||||||::..:|.|::.|.
Human    74 SLYWYSNQMAEKADGFVNLPDFTVERASEC-KKKHAFKISHPQIKTFYFAAENVQEMNVWLNKLG 137

  Fly   812 QASLKVPPSTGSKGGGDAKDLYSENDSSGEECDALVIQNLSTPSPQGNKESMSMSMTLSGGTPPS 876
            .|.:....:|..      ::.|||::....|..|      .||.|....::.|::...:..:.||
Human   138 SAVIHQESTTKD------EECYSESEQEDPEIAA------ETPPPPHASQTQSLTAQQASSSSPS 190

  Fly   877 SAPIKHERGYLDSFRKFTNTFKSSAAKPSSDIPVPTEQYRSYRKVPGG--SFGIQIGANTP---G 936
            .:...:....|::..|..::|.||.:|....:| .|....|..:..|.  :|.:|:.:..|   |
Human   191 LSGTSYSFSSLENTVKTPSSFPSSLSKERQSLP-DTVNSLSAAEDEGQPITFAVQVHSPVPSEAG 254

  Fly   937 YHDPAMPPTQIPPLVGPKLSRSSSRSSVVSGTESAVSLSASILGPPASPAPTPTPTATPTSLQHQ 1001
            .| .|:..:.:       .|.|...:|:.|...|::|.:...|..|..||.:.......|.:...
Human   255 IH-KALENSFV-------TSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKEETKVSED 311

  Fly  1002 SSEESPSQSQSQS---------PSSKSSLKKAPFNFL-HASNPNLVEFDFHTSKTLLPKMSVGNT 1056
            ...|...:|..|:         ||:|..|:|   :|: ...||::.| ..|..:||      .:|
Human   312 DEMEKLYKSLEQASLSPLGDRRPSTKKELRK---SFVKRCKNPSINE-KLHKIRTL------NST 366

  Fly  1057 LD-HGHNIQGFVTLKD---LMLRKQEE-------EAQEMYNNRVHLGVEKHKHARTESTASQQSA 1110
            |. ..|::.....|.|   |..||..|       ..|::|.               :..||....
Human   367 LKCKEHDLAMINQLLDDPKLTARKYREWKVMNTLLIQDIYQ---------------QQRASPAPD 416

  Fly  1111 MSSSVTKPLEKLPKIQSV 1128
            .:....:.|:|.|...||
Human   417 DTDDTPQELKKSPSSPSV 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910
SAM 7..74 CDD:197735
CRIC_ras_sig 82..165 CDD:287501
PDZ_signaling 206..283 CDD:238492
PH 720..814 CDD:278594 32/95 (34%)
PH_CNK_insect-like 720..810 CDD:270135 31/91 (34%)
IPCEF1NP_001124171.1 PH_CNK_mammalian-like 31..144 CDD:269962 39/113 (35%)
PH 45..140 CDD:278594 32/95 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..226 19/94 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 274..308 8/33 (24%)
CRAC domain 316..321 0/4 (0%)
CRAC domain 340..349 3/11 (27%)
Required for interaction with CYTH2. /evidence=ECO:0000269|PubMed:22085542 390..438 11/60 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 407..438 7/43 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158472
Domainoid 1 1.000 59 1.000 Domainoid score I10664
eggNOG 1 0.900 - - E1_KOG1738
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1121556at2759
OrthoFinder 1 1.000 - - FOG0001221
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.