DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnk and SAMD3

DIOPT Version :9

Sequence 1:NP_001286524.1 Gene:cnk / 36952 FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_001264114.1 Gene:SAMD3 / 154075 HGNCID:21574 Length:544 Species:Homo sapiens


Alignment Length:293 Identity:55/293 - (18%)
Similarity:111/293 - (37%) Gaps:87/293 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVENLRN 73
            |:.:||..|:  :::::...::.|.::|:.|.|||.:....::.| :.:||||.::::.::..:.
Human    28 WSVEQVCSWL--VEKNLGELVHRFQEEEVSGAALLALNDRMVQQL-VKKIGHQAVLMDLIKKYKQ 89

  Fly    74 FHYHLKN-DNLQFMALHVATAAKNLHRE----LARNHAESTK------------IDTRIL----- 116
            ....||: :|.:..||.:.|.|...:|:    ....|.|...            ||.|:|     
Human    90 N
TQGLKSPENPKKAALVMQTEAARDYRDEESSSPARHGEQMPSFYPAENLDNGLIDQRVLKQRRN 154

  Fly   117 -----------------------HDITRTIATLK----------------PLVGSLERTPFRKQE 142
                                   :|:...:|..|                .:...||.:.:...:
Human   155 VKQILARSKALQWTKSYVLPEFPYDVKCMLAEQKCPDHSMRIRIIEFLQADMTKYLEGSLYPSTQ 219

  Fly   143 MYREYCGNVLK---------CGLELATIAHRDRFALQPVPAIRQSAERLENLANF------VIQD 192
            .|.:....:|:         ||..|...|.:|||.....| |....:.:.|...|      ..:.
Human   220 QYNDVVNALLQAHPFLDEDGCGFFLWKRALKDRFKYVRRP-IEDDEQVIRNKCKFGHRRGQTRKS 283

  Fly   193 ISDPMVLQPASLNLVTLKKR----ESELGFNIE 221
            ::|   ::...:.||.:|:.    :|||..:|:
Human   284 LAD---IRFDEIKLVQIKEEAVCFDSELDEHIK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 15/64 (23%)
SAM 7..74 CDD:197735 15/64 (23%)
CRIC_ras_sig 82..165 CDD:287501 23/151 (15%)
PDZ_signaling 206..283 CDD:238492 7/20 (35%)
PH 720..814 CDD:278594
PH_CNK_insect-like 720..810 CDD:270135
SAMD3NP_001264114.1 SAM_Samd3 25..90 CDD:188925 15/64 (23%)
SAM 25..89 CDD:197735 15/63 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158473
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.