DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and PRE5

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_014045.1 Gene:PRE5 / 855362 SGDID:S000004931 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:245 Identity:78/245 - (31%)
Similarity:119/245 - (48%) Gaps:16/245 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTVE 65
            ||  |:.||....||||.|||||||||:||||.||..:|:.:....||...||....|  .|..:
Yeast     1 MF--RNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL--SSYQK 61

  Fly    66 KIVEVDKHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSD 130
            ||::.|:|:|.:.:||..|||.|....|.:|.....|:|.::::|.....:.       |....:
Yeast    62 KIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLC-------DKAQKN 119

  Fly   131 GAAAMSRPFGVAILFAGIEAGQPQLWHMDPSGTFVRHGAKAIGSGSEGA----QQNLQDLFRPDL 191
            ..:...||:||.:|..|.:.....|....|||........|||:.|:||    ::.|....:.|.
Yeast   120 TQSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDG 184

  Fly   192 TLDEAIDISLNTLKQ-VMEEKLNSTNVEVMTMTKEREFYMFTKEEVEQHI 240
            ..||.|...:..:.| :.:|.|...|:.:..:.|:..|.::..|.|.::|
Yeast   185 NPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 75/238 (32%)
proteasome_alpha_type_5 8..222 CDD:239722 70/218 (32%)
PRE5NP_014045.1 Ntn_hydrolase 6..217 CDD:412394 70/219 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.