DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and AT1G79210

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001077845.1 Gene:AT1G79210 / 844262 AraportID:AT1G79210 Length:235 Species:Arabidopsis thaliana


Alignment Length:238 Identity:76/238 - (31%)
Similarity:138/238 - (57%) Gaps:7/238 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTVEKIVEV 70
            |:|...:.||||.|:|.|:|:|:.|:..|.|::||....|||:|.||::.|.|:..::|:||..:
plant     4 SQYSFSLTTFSPSGKLVQIEHALTAVGSGQTSLGIKASNGVVIATEKKLPSILVDEASVQKIQHL 68

  Fly    71 DKHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAM 135
            ..:||...||:..|.|.|:.::|.:.:.:..:|.|.:.:....:..:|:..:|..||.       
plant    69 TPNIGTVYSGMGPDFRVLVRKSRKQAEQYLRLYKEPIPVTQLVRETATVMQEFTQSGG------- 126

  Fly   136 SRPFGVAILFAGIEAGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDIS 200
            .|||||::|.||.:...|||:.:||||::....|.|:|.....|:..|:..:..|:.||:||..:
plant   127 VRPFGVSLLVAGYDDKGPQLYQVDPSGSYFSWKASAMGKNVSNAKTFLEKRYTEDMELDDAIHTA 191

  Fly   201 LNTLKQVMEEKLNSTNVEVMTMTKEREFYMFTKEEVEQHIKNI 243
            :.|||:..|.:::|.|:|:..:..::.|.:.|..|::.::..:
plant   192 ILTLKEGFEGEISSKNIEIGKIGTDKVFRVLTPAEIDDYLAEV 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 75/234 (32%)
proteasome_alpha_type_5 8..222 CDD:239722 72/213 (34%)
AT1G79210NP_001077845.1 proteasome_alpha_type_2 6..232 CDD:239719 75/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.