DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and psma6l

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_571870.2 Gene:psma6l / 83917 ZFINID:ZDB-GENE-010502-2 Length:252 Species:Danio rerio


Alignment Length:248 Identity:68/248 - (27%)
Similarity:127/248 - (51%) Gaps:18/248 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDRGVNTFSPEGRLFQVEYAIEAI-KLGSTAIGICTPEGVVLAVEKRITSPLMVPSTVEKIVEVD 71
            :||.:..|||||||:|||||.:|| :.|.|.:||...:..||..:|:::..|:..||:..:..:.
Zfish     9 FDRHITIFSPEGRLYQVEYAFKAISQSGLTTVGIRGVDCAVLVTQKKVSDTLLDASTMTNMFRIT 73

  Fly    72 KHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMS 136
            ..|||..:|..||:|:.:.|||:|.....:.:...:.:::..:.::.|:..:..:       |..
Zfish    74 PRIGCVMTGHYADSRSQVHRARIEAGEWKYKFGYDVPVDALCRRLADLSQVYTQN-------AEM 131

  Fly   137 RPFGVAILFAGIEAGQ-PQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRP--------DLT 192
            ||.|..::...::..: |.|:..||:|.|....|.::|.....|...|:...:.        :|.
Zfish   132 RPLGCCMMLISMDPQKGPMLYKCDPAGYFCGFRATSVGVKHTEANSYLEKKIKKMQKKKEEVELD 196

  Fly   193 LDEAIDISLNTLKQVMEEKLNSTNVEVMTMTKER-EFYMFTKEEVEQHIKNIA 244
            .|.::.::::.|..|:......|.:||..:|||. :|...::.|:|:|:..||
Zfish   197 FDSSVQMAISCLSSVLCMDFKCTELEVAVVTKENPKFRTLSEVEIERHLVAIA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 66/245 (27%)
proteasome_alpha_type_5 8..222 CDD:239722 59/223 (26%)
psma6lNP_571870.2 PRE1 7..252 CDD:223711 68/248 (27%)
proteasome_alpha_type_6 8..226 CDD:239723 59/223 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.