DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and PAD1

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_190694.1 Gene:PAD1 / 824289 AraportID:AT3G51260 Length:250 Species:Arabidopsis thaliana


Alignment Length:232 Identity:84/232 - (36%)
Similarity:129/232 - (55%) Gaps:12/232 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTVEKIVEV 70
            :.|||.:..|||:|.|||||||:||::.|:.|:|:...:.|||||||:.|..|....:..|||.:
plant     2 ARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSRSARKIVSL 66

  Fly    71 DKHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAM 135
            |.||..|.:||.||||.||.:||:|||:|.....:.:::|...:.::.|..::..||.       
plant    67 DNHIALACAGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYTQSGG------- 124

  Fly   136 SRPFGVAILFAGIE--AGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAID 198
            .||||::.|..|.:  ...|.|:..||||||....|.|.|..|...::.|:..:: :....|.:.
plant   125 VRPFGLSTLIVGFDPYTRIPALYQTDPSGTFSAWKANATGRNSNSIREFLEKNYK-ESAGQETVK 188

  Fly   199 ISLNTLKQVMEEKLNSTNVEVMTMTKEREFYMFTKEE 235
            :::..|.:|:|.  ...|:||..||:|.......:||
plant   189 LAIRALLEVVES--GGKNIEVAVMTREEGVLKQLEEE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 84/230 (37%)
proteasome_alpha_type_5 8..222 CDD:239722 79/215 (37%)
PAD1NP_190694.1 proteasome_alpha_type_7 4..210 CDD:239724 79/215 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.