DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and PAC1

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_188850.1 Gene:PAC1 / 821774 AraportID:AT3G22110 Length:250 Species:Arabidopsis thaliana


Alignment Length:239 Identity:92/239 - (38%)
Similarity:137/239 - (57%) Gaps:22/239 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPST-VEKIVEVD 71
            ||.....|||||||:|||||:|||....:||||.:.:||||..||::||.|:..|| .||:.::|
plant     5 YDSRTTIFSPEGRLYQVEYAMEAIGNAGSAIGILSKDGVVLIGEKKVTSKLLQTSTSAEKMYKID 69

  Fly    72 KHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLA---IQFGDSGDSDGAA 133
            .|:.||.:|:|:||..||..|||:.|.:.|:|.|.|.:|...|::....   .|||.        
plant    70 DHVACAVAGIMSDANILINTARVQAQRYTFMYQEPMPVEQLVQSLCDTKQGYTQFGG-------- 126

  Fly   134 AMSRPFGVAILFAGIEAGQP-QLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAI 197
              .|||||:.||||.:.... ||:..||||.:....|.|:|:.::.||..|:..::.|.|.:||:
plant   127 --LRPFGVSFLFAGWDKHHGFQLYMSDPSGNYGGWKAAAVGANNQAAQSILKQDYKDDATREEAV 189

  Fly   198 DISLNTLKQVMEE-KLNSTNVEVMTMTKEREFYMFTKEEVEQHI 240
            :::|..|.:.|:. .|.|..:|:      .|.|:...:.|:.|:
plant   190 ELALKVLTKTMDSTSLTSEKLEL------AEVYLTPSKTVKYHV 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 92/239 (38%)
proteasome_alpha_type_5 8..222 CDD:239722 88/219 (40%)
PAC1NP_188850.1 proteasome_alpha_type_4 3..215 CDD:239721 88/225 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.