DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and PAA2

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_178641.1 Gene:PAA2 / 815135 AraportID:AT2G05840 Length:246 Species:Arabidopsis thaliana


Alignment Length:242 Identity:77/242 - (31%)
Similarity:126/242 - (52%) Gaps:12/242 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDRGVNTFSPEGRLFQVEYAIEAIK-LGSTAIGICTPEGVVLAVEKRITSPLMVPSTVEKIVEVD 71
            |||.:..|||||||||||||.:|:| .|.|:||:...:.|.:..:|::...|:..|:|..:..|.
plant     9 YDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQSSVSHLFPVT 73

  Fly    72 KHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMS 136
            |::|...:|:.||:|:|:::||.|.....|.|...|..:..|:.::       |........|..
plant    74 KYLGLLATGMTADSRSLVQQARNEAAEFRFQYGYEMPADILAKWIA-------DKSQVYTQHAYM 131

  Fly   137 RPFGVAILFAGI-EAGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFR--PDLTLDEAID 198
            ||.||..:..|| |...|.|:..||:|.|..|.|.:.|...:.|...|:...:  |..|.||.:.
plant   132 RPLGVVAMVLGIDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEKKMKENPAFTYDETVQ 196

  Fly   199 ISLNTLKQVMEEKLNSTNVEV-MTMTKEREFYMFTKEEVEQHIKNIA 244
            .:::.|:.|::|...:|.:|| :....:..|.....||:::|:..|:
plant   197 TAISALQSVLQEDFKATEIEVGVVRADDPLFRSLRTEEIDEHLTAIS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 76/239 (32%)
proteasome_alpha_type_5 8..222 CDD:239722 72/218 (33%)
PAA2NP_178641.1 proteasome_alpha_type_6 8..220 CDD:239723 72/217 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.