DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and psmb13a

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_571752.2 Gene:psmb13a / 64280 ZFINID:ZDB-GENE-001208-2 Length:281 Species:Danio rerio


Alignment Length:224 Identity:50/224 - (22%)
Similarity:98/224 - (43%) Gaps:26/224 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTV-EKIVEVDKHIGCATSGLMADARTLIERA 92
            :|:|.|:|..|:...:||||..:.|.||..:|...: .||..:..:|.|..:|..||.    |:.
Zfish    39 KALKTGTTIAGVVFKDGVVLGADTRATSDEVVADKMCAKIHYIAPNIYCCGAGTAADT----EKT 99

  Fly    93 RVECQNHWFVY------NERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSRPFGVAILFAGIEAG 151
            .....::..::      |.|:     ..||:.:         .|.........|..::..|::..
Zfish   100 TDMLSSNLTIFSMNSGRNPRV-----VMAVNII---------QDMLFRYHGMIGANLILGGVDCT 150

  Fly   152 QPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDISLNTLKQ-VMEEKLNST 215
            ...|:.:.|.|:..:....|:|||...|...|:|.|:.::.|::|..:..:.::. :|.:..:..
Zfish   151 GSHLYTVGPYGSMDKVPYLAMGSGDLAAMGILEDRFKVNMDLEQAKALVSDAIQAGIMCDLGSGN 215

  Fly   216 NVEVMTMTKEREFYMFTKEEVEQHIKNIA 244
            |:::..:|||...|:...:|...:.|..|
Zfish   216 NIDLCVITKEGVDYIRPHKESPYNYKRQA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 49/221 (22%)
proteasome_alpha_type_5 8..222 CDD:239722 43/200 (22%)
psmb13aNP_571752.2 proteasome_beta_type_7 45..233 CDD:239732 44/205 (21%)
Pr_beta_C 241..272 CDD:315191 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.