Sequence 1: | NP_477202.2 | Gene: | Prosalpha5 / 36951 | FlyBaseID: | FBgn0016697 | Length: | 244 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001123295.1 | Gene: | psmb3 / 573095 | ZFINID: | ZDB-GENE-040426-2682 | Length: | 205 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 38/200 - (19%) |
---|---|---|---|
Similarity: | 80/200 - (40%) | Gaps: | 20/200 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 GSTAIGICTPEGVVLAVEKRI-TSPLMVPSTVEKIVEVDKHIGCATSGLMADARTLIERARVECQ 97
Fly 98 NHWFVYNERMSIESCAQAVSTLAIQ--FGDSGDSDGAAAMSRPFGVAILFAGIE--AGQPQLWHM 158
Fly 159 DPSG-TFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAID-ISLNTLKQVMEEKLNSTNVEVMT 221
Fly 222 MTKER 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha5 | NP_477202.2 | PRK03996 | 8..243 | CDD:235192 | 38/199 (19%) |
proteasome_alpha_type_5 | 8..222 | CDD:239722 | 37/194 (19%) | ||
psmb3 | NP_001123295.1 | PRE1 | 3..198 | CDD:223711 | 38/199 (19%) |
proteasome_beta_type_3 | 6..201 | CDD:239728 | 38/199 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |