DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and PSMB8

DIOPT Version :10

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_683720.2 Gene:PSMB8 / 5696 HGNCID:9545 Length:276 Species:Homo sapiens


Alignment Length:207 Identity:49/207 - (23%)
Similarity:92/207 - (44%) Gaps:17/207 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPS-TVEKIVEVDKHIGCATSGLMA 83
            |..|:|.|     .|:|.:......||:.||:.|.::...:.: .|.|::|::.::....||..|
Human    63 RNVQIEMA-----HGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAA 122

  Fly    84 DARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSRPFGVAILFAGI 148
            |.:........||:.::....||:|:.:.::.:|.:..|:...|.|.|:           :..|.
Human   123 DCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGS-----------MICGW 176

  Fly   149 EAGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDISLNTLKQVMEEKLN 213
            :...|.|:::|..||.:.....:.|||:..|...:...:||:|:.:||.|:....:.........
Human   177 DKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSY 241

  Fly   214 STNVEVMTMTKE 225
            |..|..|...||
Human   242 SGGVVNMYHMKE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 proteasome_alpha_type_5 8..222 CDD:239722 47/202 (23%)
PSMB8NP_683720.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
proteasome_beta_type_5 73..260 CDD:239730 44/192 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.