DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and PSMB5

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_002788.1 Gene:PSMB5 / 5693 HGNCID:9542 Length:263 Species:Homo sapiens


Alignment Length:188 Identity:45/188 - (23%)
Similarity:89/188 - (47%) Gaps:23/188 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPS-TVEKIVEVDKHIGCATSGLMADA--- 85
            |..||.:. |:|.:......||::|.:.|.|:...:.| ||:|::|::.::....:|..||.   
Human    51 EPGIEMLH-GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFW 114

  Fly    86 -RTLIERARV-ECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSRPFGVAILFAGI 148
             |.|..:.|: |.:|     .||:|:.:.::.::.:..|:...|.|.|.           :..|.
Human   115 ERLLARQCRIYELRN-----KERISVAAASKLLANMVYQYKGMGLSMGT-----------MICGW 163

  Fly   149 EAGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDISLNTLKQ 206
            :...|.|:::|..|..:.....::||||..|...:...:..||.:::|.|::...:.|
Human   164 DKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 45/188 (24%)
proteasome_alpha_type_5 8..222 CDD:239722 45/188 (24%)
PSMB5NP_002788.1 proteasome_beta_type_5 60..247 CDD:239730 41/178 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.