DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and PSMA3

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_002779.1 Gene:PSMA3 / 5684 HGNCID:9532 Length:255 Species:Homo sapiens


Alignment Length:251 Identity:71/251 - (28%)
Similarity:121/251 - (48%) Gaps:32/251 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTVEKIVEVDK 72
            ||...:||||:||:||||||::|::..||||||...:|||..|||.:.|.|....:.:::..||:
Human     8 YDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDR 72

  Fly    73 HIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSR 137
            |:|.|.:||:||||:|.:.||.|..|....:...:.::..|..|:.....:       ...:..|
Human    73 HVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAY-------TLYSAVR 130

  Fly   138 PFGVAILFAGIEAGQ-PQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTL-------- 193
            |||.:.:........ .||:.:||||....:...|||...:.|:..::.|...::|.        
Human   131 PFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVA 195

  Fly   194 -----------DEAIDISLNTLKQVMEEKLNSTNVEVMTMTKEREFYMFTKEEVEQ 238
                       |:|.::.|:.:.:     |.:...|::......|...:.||.:::
Human   196 KIIYIVHDEVKDKAFELELSWVGE-----LTNGRHEIVPKDIREEAEKYAKESLKE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 71/251 (28%)
proteasome_alpha_type_5 8..222 CDD:239722 68/233 (29%)
PSMA3NP_002779.1 proteasome_alpha_type_3 5..217 CDD:239720 66/215 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.