DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and psma4

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001007998.1 Gene:psma4 / 493360 XenbaseID:XB-GENE-5837209 Length:261 Species:Xenopus tropicalis


Alignment Length:249 Identity:86/249 - (34%)
Similarity:129/249 - (51%) Gaps:30/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTV---EKIVE 69
            ||.....|||||||:|||||:|||....|.:||...:||:||.|:|....|:  ..|   |||.:
 Frog     5 YDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLL--DEVFFSEKIYK 67

  Fly    70 VDKHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLA------IQFGDSGD 128
            ::..:.|:.:|:.:||..|....|:..|.:...|.|.:   .|.|.|:.|.      .|||.   
 Frog    68 LNDDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPI---PCEQLVTALCDIKQAYTQFGG--- 126

  Fly   129 SDGAAAMSRPFGVAILFAGIEAGQP-QLWHMDPSGTFVRHGAKAIGSGSEGAQQNL-QDLFRPDL 191
                   .|||||::|:.|.:.... ||:..||||.:....|..||:.|..|...| ||....|:
 Frog   127 -------KRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGDM 184

  Fly   192 TLDEAIDISLNTLKQVME-EKLNSTNVEVMTMTKER---EFYMFTKEEVEQHIK 241
            ||..|:.:::..|.:.|: .||::..||:.|:|:|.   :..:..::|||:.||
 Frog   185 TLKSALALAVKVLNKTMDVSKLSAEKVEIATLTRENGKTKIRVLKQKEVEELIK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 86/249 (35%)
proteasome_alpha_type_5 8..222 CDD:239722 78/225 (35%)
psma4NP_001007998.1 proteasome_alpha_type_4 3..216 CDD:239721 78/225 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.