DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and Prosbeta1

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster


Alignment Length:217 Identity:40/217 - (18%)
Similarity:79/217 - (36%) Gaps:32/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTV-EKIVEVDKHIGCATSGLMADARTLIERARV 94
            :..|:|.:.:....|||:..:.|.:|...|.:.| :|:..:...:.|..||..||.:.:.:....
  Fly    12 VSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAIADIVAY 76

  Fly    95 ECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSRPFGVAILFAGI------EAGQP 153
            ....|....|:...:...|.........:.:|                 |.|||      |....
  Fly    77 SLNYHENQTNKDALVFEAASEFRNYCYSYRES-----------------LLAGIIVAGWDEQRGG 124

  Fly   154 QLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDISLNTLKQVMEEKLNSTNVE 218
            |::.:...|...|......||||......:::.:||::.|::.:......::..:....:|..|.
  Fly   125 QVYSIPLGGMLTRESCTIGGSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVV 189

  Fly   219 VMTMTKEREFYMFTKEEVEQHI 240
                    ...:.||:.:|:.|
  Fly   190 --------RIGIITKDGIERRI 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 40/217 (18%)
proteasome_alpha_type_5 8..222 CDD:239722 36/197 (18%)
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 38/210 (18%)
proteasome_beta_type_6 16..203 CDD:239731 38/211 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440992
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.