DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and Prosalpha1

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster


Alignment Length:241 Identity:69/241 - (28%)
Similarity:133/241 - (55%) Gaps:12/241 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDRGVNTFSPEGRLFQVEYAIEAI-KLGSTAIGICTPEGVVLAVEKRITSPLMVPSTVEKIVEVD 71
            :||.:..|||||||:|||||.:|| :...|.:.:.:.:..|:|.:|::|...:||.||..:..:.
  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRIT 73

  Fly    72 KHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMS 136
            |.||||.:|.:||:|:.:::||.|..|..:.|...|.::...:.::.:...:..:       |..
  Fly    74 KDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQN-------AEM 131

  Fly   137 RPFGVAILFAGI--EAGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDI 199
            ||.|.:::....  |.| |.::..||:|.|....|.::|:.:..|...|:..::|:|:.::||.:
  Fly   132 RPLGCSMVLIAYDNEIG-PSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQL 195

  Fly   200 SLNTLKQVMEEKLNSTNVEVMTMTK-EREFYMFTKEEVEQHIKNIA 244
            :::.|..|:........:|:..::| :..|.:..:.|:|:|:..||
  Fly   196 AISCLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKIA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 67/238 (28%)
proteasome_alpha_type_5 8..222 CDD:239722 62/216 (29%)
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 69/241 (29%)
proteasome_alpha_type_6 8..218 CDD:239723 62/216 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440977
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.