DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and psmb10

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001002543.2 Gene:psmb10 / 436816 ZFINID:ZDB-GENE-040718-278 Length:276 Species:Danio rerio


Alignment Length:240 Identity:53/240 - (22%)
Similarity:102/240 - (42%) Gaps:53/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EGRLFQVEY-AIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMV-PSTVEKIVEVDKHIGCATSG 80
            |..|.:..| |..|.|.|:|..|:...:||:|..:.|.|..::| .....||..:..:|.|..:|
Zfish    25 EANLSEKGYSAPNARKTGTTIAGLVFKDGVILGADTRATDDMVVADKNCMKIHYIAPNIYCCGAG 89

  Fly    81 LMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSRP------- 138
            :.|||.               |..:.||......::||        |.....|.::|.       
Zfish    90 VAADAE---------------VTTQMMSSNVELHSLST--------GRPPLVAMVTRQLKQMLFR 131

  Fly   139 ----FGVAILFAGIEAGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDI 199
                .|.:::..|::....||:.:.|.|::.:.....:|||:..|....:|.::|::.|:||   
Zfish   132 YQGHIGSSLIVGGVDVNGAQLYSVYPHGSYDKLPFLTMGSGAASAISVFEDRYKPNMELEEA--- 193

  Fly   200 SLNTLKQVMEEKL---------NSTNVEVMTMTKEREFYMFTKEE 235
                 ||::.:.:         :.:||::..:|.::..|:.|.::
Zfish   194 -----KQLVRDAITAGIFCDLGSGSNVDLCVITDKKVDYLRTYDQ 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 53/240 (22%)
proteasome_alpha_type_5 8..222 CDD:239722 50/225 (22%)
psmb10NP_001002543.2 PRE1 40..224 CDD:223711 46/214 (21%)
proteasome_beta_type_7 43..231 CDD:239732 45/218 (21%)
Pr_beta_C 237..270 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.