DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and Prosalpha3T

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster


Alignment Length:249 Identity:71/249 - (28%)
Similarity:119/249 - (47%) Gaps:28/249 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTVEKIVEVDK 72
            :|.....|||||||:|||||:||.....|.:|:....||:||.|:.:...:.....|.:|..:::
  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATERSVDKLMDTSIPVPRISWLNE 69

  Fly    73 HIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLA------IQFGDSGDSDG 131
            :|.|..:|..||...|:.:.|:..|.:.|.:.|.:   .|.|.|:.|.      .|:|.      
  Fly    70 NIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMI---PCEQLVTNLCDIKQAYTQYGG------ 125

  Fly   132 AAAMSRPFGVAILFAGIEAGQP-QLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQ-DLFRPDL--- 191
                .|||||:.|:.|.:.... ||:..||||.:....|..||..|..|.:.|| :||....   
  Fly   126 ----KRPFGVSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSP 186

  Fly   192 TLDEAIDISLNTLKQVM-EEKLNSTNVEVMTMTK---EREFYMFTKEEVEQHIK 241
            :::||.|:::..:...: .:.|....:|:..:.:   ...|::..|.|:.:.|:
  Fly   187 SVEEAKDVAIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKNEIHRLIE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 71/249 (29%)
proteasome_alpha_type_5 8..222 CDD:239722 67/225 (30%)
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 71/249 (29%)
Ntn_hydrolase 3..218 CDD:294319 67/225 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440990
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.