DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and Prosbeta3

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster


Alignment Length:209 Identity:38/209 - (18%)
Similarity:81/209 - (38%) Gaps:38/209 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GSTAIGICTPEGVVLAVEKRITSPLMVPST-VEKIVEVDKHIGCATSGLMADARTLIERARVECQ 97
            |...:.:...:.|.:|.:.|........|| .:|:..:...:....:||..|..|:.:|.... :
  Fly     8 GGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFR-K 71

  Fly    98 NHWFVYNERMSIESCAQAVSTLAI------QFGDSGDSDGAAAMSRPFGVAILFAGIE--AGQPQ 154
            |   :|..|.:.|.|.:..|.:..      :||             |:.:..:.||::  ..:|.
  Fly    72 N---LYETRENREMCPKPFSAMMSSFLYEHRFG-------------PYFIEPVVAGLDPKTMEPF 120

  Fly   155 LWHMDPSG------TFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDISLNTLKQVME-EKL 212
            :.:||..|      .||     ..|:.:|......:.|::|||..|:..::...::....: :.:
  Fly   121 ICNMDLIGCPNAPDDFV-----VAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAM 180

  Fly   213 NSTNVEVMTMTKER 226
            :.....|..:.|::
  Fly   181 SGWGATVYIIEKDK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 38/209 (18%)
proteasome_alpha_type_5 8..222 CDD:239722 37/203 (18%)
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 38/209 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440986
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.