DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and psma8

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_998331.1 Gene:psma8 / 406445 ZFINID:ZDB-GENE-040426-2194 Length:251 Species:Danio rerio


Alignment Length:241 Identity:84/241 - (34%)
Similarity:137/241 - (56%) Gaps:12/241 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTVEKIVEV 70
            :.|||.:..|||:|.|||||||.||:|.||||:||...:.|||.|||:..:.|....||.||..:
Zfish     3 ARYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGKDIVVLGVEKKSVAKLQEERTVRKICAL 67

  Fly    71 DKHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAM 135
            |:|:..|.:||.||||.:|.|||||||:|.....:.:::|...:.::||..::..|..       
Zfish    68 DEHVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIATLKQRYTQSNG------- 125

  Fly   136 SRPFGVAILFAGIE-AGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTL--DEAI 197
            .||||::.|..|.: .|.|:|:..|||||:....|.|||..::..::.|:..:..:...  ::||
Zfish   126 RRPFGISALIVGFDYDGTPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTDEAIASDNDAI 190

  Fly   198 DISLNTLKQVMEEKLNSTNVEVMTMTKEREFYMFTKEEVEQHIKNI 243
            .:::..|.:|::.  ...|:|:..:.:.:...:...:|:|..:..|
Zfish   191 KLAIKALLEVVQS--GGKNIELAVIRRNQPLKILESKEIETLVAEI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 83/237 (35%)
proteasome_alpha_type_5 8..222 CDD:239722 81/216 (38%)
psma8NP_998331.1 proteasome_alpha_type_7 5..213 CDD:239724 81/216 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.