DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and Prosbeta7

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster


Alignment Length:244 Identity:46/244 - (18%)
Similarity:94/244 - (38%) Gaps:72/244 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVP-STVEKIVEVDKH 73
            |.:.|..|.|    .:::..:...|::.:||....||:||.:..::...|.. ..:|::.:|:|:
  Fly    37 RELTTMGPYG----TKHSTASSTTGTSVLGIRYDSGVMLAADTLVSYGSMARYQNIERVFKVNKN 97

  Fly    74 IGCATSGLMADARTL---IERARVE---CQNH----------WF---VYNERMSIESCAQAVSTL 119
            |....||..||.:::   |::..:|   |.::          |.   :||.|             
  Fly    98 ILLGGSGDFADIQSIKRNIDQKMIEDQCCDDNIEMKPKSLASWMTRVLYNRR------------- 149

  Fly   120 AIQFGDSGDSDGAAAMSRPFGVAILFAGIE-AGQPQLWHMDPSGT----------FVRHGAKAIG 173
                          :...|..:.::..|:: .|.|.|.::|..|.          |.||.|..:.
  Fly   150 --------------SRMNPLYIDVVVGGVDNEGTPYLANVDLRGRSYEDYVVATGFARHLAVPLV 200

  Fly   174 SGSEGAQQNLQDLFRPDLTLDEAIDISLNTLKQVMEEKLNSTNVEVMTM 222
            ...:...:        |.|..||.:: :.|..:|:..: ::.|:...|:
  Fly   201 REKKPKDR--------DFTAVEASEL-IRTCMEVLYYR-DTRNISQYTV 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 46/244 (19%)
proteasome_alpha_type_5 8..222 CDD:239722 45/242 (19%)
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 41/217 (19%)
PRE1 60..232 CDD:223711 39/208 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440991
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.