DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and Prosbeta2R2

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster


Alignment Length:219 Identity:51/219 - (23%)
Similarity:88/219 - (40%) Gaps:25/219 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DRGVNTFSPEGRLFQ--------VEYAIE---AIKLGSTAIGICTPEGVVLAVEKRITS-PLMVP 61
            ||......|.|..|.        .|..:|   :...|:|.:||....||::..|.|.|| .::..
  Fly    13 DRSPFLCGPSGFTFDNCLRNKQLKENGLEEPNSFTTGTTVVGIVFDGGVIIGAESRATSGGIVFS 77

  Fly    62 STVEKIVEVDKHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCA-QAVSTLAIQFGD 125
            .|..||:|:..:|..|.:|...|.:.|:|..|.:.:.|......|.....|| |.:..|..:|..
  Fly    78 KTCRKIIELQANIFAAGAGTARDTKALVELTRAQLELHRMNTGFRKVPVCCANQMIRQLLFRFNG 142

  Fly   126 SGDSDGAAAMSRPFGVAILFAGIEAGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPD 190
            :.|:|            ::..|.:.....|:.....|:.......:||||.:.:...|:..:..|
  Fly   143 NIDAD------------MIIGGADNTGAHLFCTRSDGSTDTAPFTSIGSGYQVSMSILESRWSED 195

  Fly   191 LTLDEAIDISLNTLKQVMEEKLNS 214
            |:.:.|..::.:.:...|:..|.|
  Fly   196 LSEESACALACDAVAAGMKNDLCS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 51/219 (23%)
proteasome_alpha_type_5 8..222 CDD:239722 51/219 (23%)
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 51/219 (23%)
proteasome_beta_type_7 50..239 CDD:239732 43/182 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440994
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.