DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and Prosbeta2

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster


Alignment Length:201 Identity:39/201 - (19%)
Similarity:85/201 - (42%) Gaps:14/201 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KLGSTAIGICTPEGVVLAVEKRIT-SPLMVPSTVEKIVEVDKHIGCATSGLMADARTLIERARVE 95
            |.|:|.:||...:||:|..:.|.| .|::......||..:.|:|.|..:|..||.....:....:
  Fly    37 KTGTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISSQ 101

  Fly    96 CQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSRPFGVAILFAGIEAGQPQLWHMDP 160
            .:.|....:..:.:.:....:..:..::            ......|::..|::...|.::.:.|
  Fly   102 LELHRLQTDREVRVVAANTMLKQMLFRY------------QGHISAALVLGGVDKTGPHIYSIHP 154

  Fly   161 SGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDISLNTLKQVMEEKLNS-TNVEVMTMTK 224
            .|:..:.....:||||..|....:..::|||:.:|...:..:.:...:...|.| :|:::..:.|
  Fly   155 HGSSDKLPYATMGSGSLAAMTVFESRWKPDLSEEEGKKLVRDAIASGVFNDLGSGSNIDLCVIRK 219

  Fly   225 EREFYM 230
            ....|:
  Fly   220 GSVEYL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 39/201 (19%)
proteasome_alpha_type_5 8..222 CDD:239722 37/191 (19%)
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 36/196 (18%)
proteasome_beta_type_7 42..228 CDD:239732 36/196 (18%)
Pr_beta_C 232..264 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440995
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.