DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and Prosalpha4T2

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster


Alignment Length:241 Identity:81/241 - (33%)
Similarity:121/241 - (50%) Gaps:16/241 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTVEKIVEVDK 72
            |||.|..:||:|.|.|||||.||::.|||.:|:.|...:|:.||||....|.....|.||..:|.
  Fly     5 YDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKICMLDD 69

  Fly    73 HIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSR 137
            |:....|||.||||.|:.||::|.|:|...:.:..::|...:.::.|...:..|..       .|
  Fly    70 HVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNG-------RR 127

  Fly   138 PFGVAILFAGI-EAGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTL-DEAIDIS 200
            |||::.|..|. |.|.|.|:..||||.|....|...|..|:..:..::......||: |||..|.
  Fly   128 PFGLSCLVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTIADEAAAIK 192

  Fly   201 --LNTLKQVMEEKLNSTNVEVMTMTKEREFYMFTKE---EVEQHIK 241
              :.||..|  ..||.|.:||..:...:...|...:   ::|:.::
  Fly   193 HIVRTLVSV--SSLNHTQMEVAVLKYRQPLRMIDHQVLADLERTVR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 81/241 (34%)
proteasome_alpha_type_5 8..222 CDD:239722 79/217 (36%)
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 79/218 (36%)
Ntn_hydrolase 5..214 CDD:294319 79/217 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440980
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.