DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and Prosbeta5R1

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_611776.1 Gene:Prosbeta5R1 / 37690 FlyBaseID:FBgn0034842 Length:315 Species:Drosophila melanogaster


Alignment Length:172 Identity:46/172 - (26%)
Similarity:83/172 - (48%) Gaps:20/172 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GSTAIGICTPEGVVLAVEKRITSPLMVPS-TVEKIVEVDKHIGCATSGLMADA----RTLIERAR 93
            |:|.:|.....||:|..:.|.||...:.| |:.||||::.::....:|..||.    |.|.:   
  Fly    71 GTTTLGFKYRGGVILCADSRATSGQYIGSQTMRKIVELNDYMLGTLAGGAADCVYWDRVLAK--- 132

  Fly    94 VECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSRPFGVAILFAGIEAGQPQLWHM 158
             ||:.|...|.:||::::.|:.:..::.::...|           ..:.::.||.:...|:|.::
  Fly   133 -ECRLHQLRYRKRMTVDTAARIICNISTEYKGMG-----------LVMGMMLAGFDDEGPKLIYV 185

  Fly   159 DPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDIS 200
            |..|........::||||..|...|...:|.||:..||.|::
  Fly   186 DSEGMRSHGQVFSVGSGSPYALGVLDTGYRYDLSDQEAYDLA 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 46/172 (27%)
proteasome_alpha_type_5 8..222 CDD:239722 46/172 (27%)
Prosbeta5R1NP_611776.1 PTZ00488 39..272 CDD:185666 46/172 (27%)
proteasome_beta_type_5 72..259 CDD:239730 45/171 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440911
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.