DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and psmb5

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_571226.1 Gene:psmb5 / 30387 ZFINID:ZDB-GENE-990415-215 Length:269 Species:Danio rerio


Alignment Length:179 Identity:50/179 - (27%)
Similarity:87/179 - (48%) Gaps:22/179 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GSTAIGICTPEGVVLAVEKRITSPLMVPS-TVEKIVEVDKHIGCATSGLMADA----RTLIERAR 93
            |:|.:......||::||:.|.|:...:.| ||:|::|::.::....:|..||.    |.|..:.|
Zfish    65 GTTTLAFKFQHGVIVAVDSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCR 129

  Fly    94 V-ECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSRPFGVAILFAGIEAGQPQLWH 157
            : |.:|     .||:|:.:.::.::.:..|:...|.|.|.           :..|.:...|.|::
Zfish   130 IYELRN-----KERISVAAASKLLANMVYQYKGMGLSMGT-----------MVCGWDKRGPGLYY 178

  Fly   158 MDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDISLNTLKQ 206
            :|..|..|..|..|:||||..|...:....|.|||:|||.|:....:.|
Zfish   179 VDSEGNRVCGGLFAVGSGSMYAYGVVDSGLRYDLTIDEACDLGRRAIYQ 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 50/179 (28%)
proteasome_alpha_type_5 8..222 CDD:239722 50/179 (28%)
psmb5NP_571226.1 PTZ00488 44..268 CDD:185666 50/179 (28%)
proteasome_beta_type_5 66..253 CDD:239730 49/178 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.