DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and Psmb2

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_058980.1 Gene:Psmb2 / 29675 RGDID:61874 Length:201 Species:Rattus norvegicus


Alignment Length:204 Identity:44/204 - (21%)
Similarity:82/204 - (40%) Gaps:27/204 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IGICTPEGVVLAVEKRITSPLM-VPSTVEKIVEVDKHIGCATSGLMADARTLIERARVECQNHWF 101
            |||..|:.|::|.::...|.:: :....:|:.::.:.|.....|...|.....|..:...|    
  Rat     5 IGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQ---- 65

  Fly   102 VYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSR-PFGVAILFAGIEAGQ-PQLWHMDPSGTF 164
            :|..|...|    ...|.|..|.....:|  ...|| |:.|.:|.||.:..: |.|::||.....
  Rat    66 LYKMRNGYE----LSPTAAANFTRRNLAD--CLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAAL 124

  Fly   165 VRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDISLNTLKQVME--------------EKLNST 215
            .:....|.|.|:......|...:.|.::.:.|:::....|:::.:              :|....
  Rat   125 AKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRVIDKDGIH 189

  Fly   216 NVEVMTMTK 224
            |:|.:|.||
  Rat   190 NLENITFTK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 44/204 (22%)
proteasome_alpha_type_5 8..222 CDD:239722 41/200 (21%)
Psmb2NP_058980.1 proteasome_beta_type_2 1..192 CDD:239727 40/196 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.