DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and Psma7

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001008218.1 Gene:Psma7 / 29674 RGDID:61851 Length:248 Species:Rattus norvegicus


Alignment Length:242 Identity:87/242 - (35%)
Similarity:139/242 - (57%) Gaps:18/242 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTVEKIVEVDK 72
            |||.:..|||:|.|||||||.||:|.||||:|:...:.|||.|||:..:.|....||.||..:|.
  Rat     3 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDD 67

  Fly    73 HIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSR 137
            ::..|.:||.||||.:|.|||||||:|.....:.:::|...:.:::|..::..|..       .|
  Rat    68 NVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNG-------RR 125

  Fly   138 PFGVAILFAGIE-AGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDISL 201
            |||::.|..|.: .|.|:|:..|||||:....|.|||.|::..::.|:..:     .|:||:...
  Rat   126 PFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNY-----TDDAIETDD 185

  Fly   202 NTLKQVMEEKL-----NSTNVEVMTMTKEREFYMFTKEEVEQHIKNI 243
            .|:|.|::..|     ...|:|:..|.:::...:.:.||:|:::..|
  Rat   186 LTIKLVIKALLEVVQSGGKNIELAVMRRDQPLKILSPEEIEKYVAEI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 86/240 (36%)
proteasome_alpha_type_5 8..222 CDD:239722 82/219 (37%)
Psma7NP_001008218.1 PRK03996 1..230 CDD:235192 86/238 (36%)
proteasome_alpha_type_7 3..211 CDD:239724 82/219 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.