DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and Psma6

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_058979.1 Gene:Psma6 / 29673 RGDID:61849 Length:246 Species:Rattus norvegicus


Alignment Length:246 Identity:67/246 - (27%)
Similarity:132/246 - (53%) Gaps:20/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDRGVNTFSPEGRLFQVEYAIEAIKLGS-TAIGICTPEGVVLAVEKRITSPLMVPSTVEKIVEVD 71
            :||.:..|||||||:|||||.:||..|. |::.:...:..|:..:|::...|:..|||..:.::.
  Rat     9 FDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKIT 73

  Fly    72 KHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMS 136
            ::|||..:|:.||:|:.::|||.|..|..:.|...:.::...:.::.::..:..:       |..
  Rat    74 ENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQN-------AEM 131

  Fly   137 RPFGVAILFAGIEAGQ-PQLWHMDPSGTFVRHGAKAIGSG------SEGAQQNLQDLFRPDLTLD 194
            ||.|..::..||:..| ||::..||:|.:.  |.||..:|      :...::.::..|  |.|.:
  Rat   132 RPLGCCMILIGIDEEQGPQVYKCDPAGYYC--GFKATAAGVKQTESTSFLEKKVKKKF--DWTFE 192

  Fly   195 EAIDISLNTLKQVMEEKLNSTNVEVMTMTKER-EFYMFTKEEVEQHIKNIA 244
            :.::.::..|..|:......:.:||..:|.|. :|.:.|:.|::.|:..:|
  Rat   193 QTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALA 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 66/243 (27%)
proteasome_alpha_type_5 8..222 CDD:239722 60/221 (27%)
Psma6NP_058979.1 proteasome_alpha_type_6 8..220 CDD:239723 60/221 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.